PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC12882_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family GATA
Protein Properties Length: 303aa    MW: 33691.6 Da    PI: 9.2123
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC12882_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA61.41.1e-19221255135
         GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                  C++C +tkTp+WR+gp+g+ktLCnaCG+++r+ +l
  RrC12882_p1 221 CTHCESTKTPQWREGPNGPKTLCNACGVRFRSGRL 255
                  *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF577161.33E-14215277No hitNo description
SMARTSM004014.6E-18215269IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.925219251IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.101.2E-14219252IPR013088Zinc finger, NHR/GATA-type
CDDcd002026.91E-17220269No hitNo description
PROSITE patternPS003440221246IPR000679Zinc finger, GATA-type
PfamPF003201.5E-17221255IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 303 aa     Download sequence    Send to blast
MNNGGPWLPE EDFKGLTDNF FDDLINHIDF PLEDIETTNE EADWGADFKN LIPPPSDVLT  60
SLSSEFTRAG TNGQLVEGAH KKPVPTLKQS GGISSTVDTS LPDVKVSKLF QSSSPVSVLE  120
NNAANGSAAS FQNQNRAQRL AFPVKGIRSK RKRPTIPTFL SRHSFLSEML ERKFALDDDS  180
DSEDTYLSSE SSAKRRRKKK NSNVSHSPEP FSADGTVVRK CTHCESTKTP QWREGPNGPK  240
TLCNACGVRF RSGRLLPEYR PASSPTFIPT VHSNSHRKII EMRRKDEEGQ FGTGMARGFR  300
YRA
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1193199KRRRKKK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013692534.10.0PREDICTED: putative GATA transcription factor 13
RefseqXP_013630850.10.0PREDICTED: putative GATA transcription factor 13
SwissprotQ6DBP81e-100GAT11_ARATH; GATA transcription factor 11
TrEMBLA0A0D3BU680.0A0A0D3BU68_BRAOL; Uncharacterized protein
STRINGBra011956.1-P1e-169(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16812589
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08010.24e-94GATA transcription factor 11